Sequence Details - sb|3472251|

> AGAP005449-PA [Anopheles gambiae str. PEST] gb
MFDQLPPISRYLFRLSCTRLGQWAIGYVTEDHQILQTIPNNKSLCEALIRGAQDGYYLYPDGKDKNPDLNVIQHDKVKEVIQVTEEEYEIYTSMGTTMQQCKICQENDKDVKLQPCNHLMCSECLERCLEQWSNSMTCPFCRGPVKDYESVKVDPFHDNPGSSTVFMSR

Public Database Homology

source	description	e-value
	AGAP005449-PA [Anopheles gambiae str. PEST] gb	2e-46
	PREDICTED: similar to Cbl-b, partial [Strongylocentrotus purpuratus]	1.0000000000000001e-45
	PREDICTED: similar to Cbl CG7037-PB, isoform B [Apis mellifera]	1.0000000000000001e-45
	PREDICTED: similar to cbl-b, partial [Strongylocentrotus purpuratus]	2.0000000000000003e-45
	PREDICTED: similar to cbl-b [Strongylocentrotus purpuratus]	2.0000000000000003e-45
	CBL_MOUSE RecName: Full=E3 ubiquitin-protein ligase CBL; AltName: Full=Signal transduction protein CBL; AltName: Full=Proto-oncogene c-Cbl; AltName: Full=Casitas B-lineage lymphoma proto-oncogene	2e-46
	CBL_HUMAN RecName: Full=E3 ubiquitin-protein ligase CBL; AltName: Full=Signal transduction protein CBL; AltName: Full=Proto-oncogene c-Cbl; AltName: Full=Casitas B-lineage lymphoma proto-oncogene; AltName: Full=RING finger protein 55	2e-46
	CBLBA_XENLA RecName: Full=E3 ubiquitin-protein ligase CBL-B-A; AltName: Full=Signal transduction protein CBL-B-A; AltName: Full=SH3-binding protein CBL-B-A	7e-46
	CBLB_XENTR RecName: Full=E3 ubiquitin-protein ligase CBL-B; AltName: Full=Signal transduction protein CBL-B; AltName: Full=SH3-binding protein CBL-B	8e-46
	CBLB_MOUSE RecName: Full=E3 ubiquitin-protein ligase CBL-B; AltName: Full=Signal transduction protein CBL-B; AltName: Full=SH3-binding protein CBL-B; AltName: Full=Casitas B-lineage lymphoma proto-oncogene b	1.0000000000000001e-45

Pfam Domains

domain id	description	e-value	start	stop
PF00097	Zinc finger, C3HC4 type (RING finger)	1.0000000000000001e-45	101	141
PF02762	CBL proto-oncogene N-terminus, SH2-like domain	1.0000000000000001e-45	10	69

KEGG Pathways

pathway id	description		e-value
K04707	ErbB signaling pathway	view pathway diagram	7e-52
K04707	Ubiquitin mediated proteolysis	view pathway diagram	7e-52
K04707	Endocytosis	view pathway diagram	7e-52
K04707	Jak-STAT signaling pathway	view pathway diagram	7e-52
K04707	T cell receptor signaling pathway	view pathway diagram	7e-52
K04707	Insulin signaling pathway	view pathway diagram	7e-52
K04707	Bacterial invasion of epithelial cells	view pathway diagram	7e-52
K04707	Pathways in cancer	view pathway diagram	7e-52
K04707	Chronic myeloid leukemia	view pathway diagram	7e-52

GO term(s)

GO:0005886 plasma membrane

GO:0007166 cell surface receptor linked signal transduction

GO:0007173 epidermal growth factor receptor signaling pathway

GO:0009629 response to gravity

GO:0017124 SH3 domain binding

GO:0019901 protein kinase binding

GO:0042110 T cell activation

GO:0045121 membrane raft

GO:0050860 negative regulation of T cell receptor signaling pathway