Sequence Details - sb|3473925|

>GBB_LYMST RecName: Full=Guanine nucleotide-binding protein subunit beta
MAGDADLTAEANQLKQKIKDARKEVCDTDLVNECGNVEVLKLAIRVRKTLRGHLSKVYAMDWATDSRHLVSASQDGKLIVWDAYTANKVHAIPLRSSWVMTCTYAPSGNFVACGGLDNLCSIYNLKTKEGNVRVSCSPIKSSRR

Public Database Homology

source	description	e-value
	guanine nucleotide binding protein, beta subunit [Daphnia pulex]	1.9999999999999998e-50
	guanine nucleotide-binding protein subunit beta 1 [Culex tarsalis]	3e-50
	guanine nucleotide-binding protein beta 3 (g protein beta3) [Aedes aegypti] ref	5e-50
	AGAP005911-PA [Anopheles gambiae str. PEST] gb	5e-50
	guanine nucleotide-binding protein beta 1 4 (G protein beta1 4) [Schistosoma mansoni] emb	7e-50
	GBB_LYMST RecName: Full=Guanine nucleotide-binding protein subunit beta	4e-51
	GBB_LOLFO RecName: Full=Guanine nucleotide-binding protein subunit beta	1.9999999999999998e-50
	GBB1_CAEEL Guanine nucleotide-binding protein subunit beta-1 sp	5e-50
	GBB1_DANRE RecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1; AltName: Full=Transducin beta chain 1	7.999999999999999e-50
	GBB1_PONAB RecName: Full=Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1; AltName: Full=Transducin beta chain 1	1.0000000000000001e-49

Pfam Domains

domain id	description	e-value	start	stop
PF00400	WD domain, G-beta repeat	1.0000000000000001e-49	48	82

KEGG Pathways

pathway id	description		e-value
K04536	Chemokine signaling pathway	view pathway diagram	6e-60
K04536	Retrograde endocannabinoid signaling	view pathway diagram	6e-60
K04536	Glutamatergic synapse	view pathway diagram	6e-60
K04536	Cholinergic synapse	view pathway diagram	6e-60
K04536	Serotonergic synapse	view pathway diagram	6e-60
K04536	GABAergic synapse	view pathway diagram	6e-60
K04536	Dopaminergic synapse	view pathway diagram	6e-60
K04536	Taste transduction	view pathway diagram	6e-60
K04536	Phototransduction	view pathway diagram	6e-60
K04536	Morphine addiction	view pathway diagram	6e-60
K07972	MAPK signaling pathway - yeast	view pathway diagram	2.0000000000000002e-60
K07972	Phototransduction - fly	view pathway diagram	2.0000000000000002e-60

GO term(s)

GO:0000003 reproduction

GO:0000132 establishment of mitotic spindle orientation

GO:0002119 nematode larval development

GO:0003924 GTPase activity

GO:0005834 heterotrimeric G-protein complex

GO:0007186 G-protein coupled receptor protein signaling pathway

GO:0007204 elevation of cytosolic calcium ion concentration

GO:0008283 cell proliferation

GO:0009790 embryonic development

GO:0046662 regulation of oviposition